PNC27

No Comments

$800.00

Quantity: 25mg

SKU: 3904001 Category: Tag:

Description

Product name: PNC27

Synonyms: p53 12–26-leader,p53-derived peptide, PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG,

Sequence: Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH

IUPAC Name:

Catalog #: 3904001

CAS No.: —

Molecular Formula: C188H293N53O44S

Molecular Weight: 4031.7

Description: The PNC27 peptide comprises the mdm-2 binding domain of the p53 protein (residues 12–26) containing a C-terminal Penetratin sequence as carrier (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG). Unexpectedly, this peptide was found to induce selective necrosis in various carcinogenic cell types, as it has an amphipatic structure which allows it to integrate into the cell membrane forming pores, producing membrane disruption and cell death by a p53-independent mechanism. The selectivity on tumor cells would be given by the presence of mdm-2 on the plasma membrane of these cells, which is related to the role of mdm-2 in E-cadherin ubiquitination and degradation. Thus, in non-tumor cells, PNC27 enters the cell, but in cancer cells it is retained in the membrane due to its affinity for mdm-2, and forms pores.

Additional information

Purity

98%

Package size

5mg

Leave a Reply

Your email address will not be published. Required fields are marked *