No Comments


Quantity: 25mg

SKU: 3904008 Category: Tag:


Product name: OAIP-1

Synonyms: orally active insecticidal peptide 1,U1-TRTX-Sp1a,DCGHLHDPCPNDRPGHRTCCIGLQCRYGKCLVRV,

Sequence: Asp-Cys-Gly-His-Leu-His-Asp-Pro-Cys-Pro-Asn-Asp-Arg-Pro-Gly-His-Arg-Thr-Cys-Cys-Ile-Gly-Leu-Gln-Cys-Arg-Tyr-Gly-Lys-Cys-Leu-Val-Arg-Val-NH2(disulfide (1-4,2-5,3-6))

Uniprot IDK7N5K9

Catalog #: 3904008

CAS No.: —

Molecular Formula: C157H248N56O44S6

Molecular Weight: 3816.39

Description: Orally active insecticidal peptide (OAIP-1) is highly lethal to termites, mealworms, and the cotton bollworm. OAIP-1 remains completely intact for at least one week at temperatures up to 30°C and is stable for hours in insect hemolymph.

Additional information



Package size


Leave a Reply

Your email address will not be published. Required fields are marked *